PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G269900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 438aa    MW: 47289 Da    PI: 9.976
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G269900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81.1e-24154198145
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Sobic.004G269900.2.p 154 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 198
                           79****************************************997 PP

2QLQ60.64.3e-2191126237
                   QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                           +FT+aQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  Sobic.004G269900.2.p  91 PFTPAQYEELEQQALIYKYLVAGVPVPPDLVVPIRR 126
                           9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-1290126IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.1E-1591125IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.94991126IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486154198IPR014977WRC domain
PfamPF088794.7E-21155197IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MPLFPRQAPT TAPPRPRRRR SSPSAAPPRS PRKYSTTSTR RRRFARGSPI VAVWFAVVTR  60
WYVCWCRGGG GGLGEDAQLS SRWPAARPVV PFTPAQYEEL EQQALIYKYL VAGVPVPPDL  120
VVPIRRGLDS LATRFYGHPT LGGYGTYYLG KKLDPEPGRC RRTDGKKWRC SKEAAPDSKY  180
CERHMHRGRN RSRKPVETQL VPQSQPPATA AAVSAAPPLA LAAATTTTNG SCFQNHSLYP  240
AIAGSTGGGG GASNISTPFS SSMGSSQLHM DNAASYAALG GGTAKDLRYN AYGIRSLAEE  300
HNQLIAEAID SSMENQWRLP PSQTSSFPLS SYPQLGALSN LGQSTVTSLS KMERQQPLSF  360
LGNSEFGAME SAAKQQENQT LRPFFDEWPK ARDSWPGLSD DNAASLAPSF PATQLSMSIP  420
MASSDFSVAS SQSPNDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279720.0KJ727972.1 Zea mays clone pUT6086 GRF transcription factor (GRF6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452692.10.0hypothetical protein SORBIDRAFT_04g030770
SwissprotQ6ZIK51e-159GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLC5Y0D70.0C5Y0D7_SORBI; Putative uncharacterized protein Sb04g030770
STRINGSb04g030770.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-41growth-regulating factor 5